PNC-27 (Coming Soon)

PNC-27 is a synthetic, 32-amino-acid research peptide composed of an HDM-2-binding region derived from the p53 protein and a membrane-penetrating leader sequence. It is being investigated for its interaction with HDM-2 expressed on the surface of certain cancer-cell models and for its potential to promote membrane disruption under laboratory conditions.

Premium research-grade, supplied as a lyophilized compound for laboratory research use by qualified professionals. For laboratory research use only. Not for human or animal use.

Technical Specifications:

Purity: >99% (HPLC)
Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S
Molecular Weight: 4031.74 g/mol
Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
Format: Lyophilized powder
Classification: Synthetic p53-derived HDM-2-targeting peptide

Available concentration: 5 mg

Research Context

PNC-27 is an investigational peptide widely studied in laboratory cancer-cell models for its interaction with membrane-associated HDM-2. Current research focuses on peptide–protein binding, membrane integrity, selective cytotoxicity in HDM-2-expressing cell models, and the mechanisms of peptide-induced membrane pore formation. Ongoing preclinical investigations continue to explore its potential role in targeted oncology research and cancer-cell biology.

Handling & Storage

Storage Conditions: 2–8 °C, protected from light

Stability: Lyophilized format supports extended stability when stored under recommended conditions.

Reconstitution: For laboratory research protocols only, using appropriate sterile laboratory techniques.